Unexpected Receptor Functional Mimicry Elucidates Activation of Coronavirus Fusion.

Products Related to West Nile, Dengue, Malaria, T.B, Chikungunya, Sars, Zika

Product# 17011 rSars Spike(S) Protein (EUK)

Product# 63001 Recombinant West Nile Envelope E Protein (E.coli)

Product# 17101 Murine Anti- SARS Monoclonal Antibody

Summary

Recent outbreaks of severe acute respiratory syndrome and Middle East respiratory syndrome, along with the threat of a future coronavirus-mediated pandemic, underscore the importance of finding ways to combat these viruses. The trimeric spike transmembrane glycoprotein S mediates entry into host cells and is the major target of neutralizing antibodies. To understand the humoral immune response elicited upon natural infections with coronaviruses, we structurally characterized the SARS-CoV and MERS-CoV S glycoproteins in complex with neutralizing antibodies isolated from human survivors. Although the two antibodies studied blocked attachment to the host cell receptor, only the anti-SARS-CoV S antibody triggered fusogenic conformational changes via receptor functional mimicry. These results provide a structural framework for understanding coronavirus neutralization by human antibodies and shed light on activation of coronavirus membrane fusion, which takes place through a receptor-driven ratcheting mechanism.

Keywords: coronavirus, SARS-CoV, MERS-CoV, spike glycoprotein, class I fusion protein, membrane fusion, neutralizing antibodies, glycoproteomics, N-linked glycosylation

Graphical Abstract

An external file that holds a picture, illustration, etc.
Object name is fx1_lrg.jpg

Introduction

Coronaviruses are enveloped viruses responsible for up to 30% of mild respiratory tract infections and atypical pneumonia in humans. The severe acute respiratory syndrome coronavirus (SARS-CoV) emerged in 2002 in the Guangdong province of China and spread across the globe, resulting in 8,000 infections and nearly 800 deaths in 37 countries. The Middle East respiratory syndrome coronavirus (MERS-CoV) emerged in the Arabian peninsula in 2012 and has caused numerous outbreaks in humans, with a fatality rate of 35%. SARS-CoV is of bat origin and crossed the species barrier using palm civets as putative intermediate hosts (Ge et al., 2013, Li et al., 2005b, Wang et al., 2005), whereas MERS-CoV is found in dromedary camels as a natural reservoir (Haagmans et al., 2014, Memish et al., 2013). Surveillance studies in bats detected numerous coronaviruses sharing high nucleotide sequence similarity with pathogenic human coronaviruses (Hu et al., 2017, Menachery et al., 2015, Menachery et al., 2016), suggesting that additional zoonotic transmission events are likely to occur in the future. Currently, no specific treatments or vaccines are available against any of the six human-infecting coronaviruses.

Coronavirus entry into host cells is mediated by the trimeric transmembrane spike (S) glycoprotein. S is composed of two functional subunits responsible for binding to the host cell receptor (S1 subunit) and fusion of the viral and cellular membranes (S2 subunit) (Gui et al., 2017, Kirchdoerfer et al., 2016, Pallesen et al., 2017, Shang et al., 2017, Shang et al., 2018, Walls et al., 2016a, Walls et al., 2016b, Walls et al., 2017, Xiong et al., 2017, Yuan et al., 2017). We have previously determined structures of the mouse hepatitis virus (MHV) S ectodomain in the pre-fusion and post-fusion states, which provided snapshots of the start and end points of the membrane fusion reaction (Walls et al., 2016a, Walls et al., 2017). These studies demonstrated that membrane fusion involves large conformational changes in the C-terminal (S2) subunit, similarly to other class I fusion proteins.

Proteolytic processing and receptor-binding act in synergy to induce large-scale S conformational changes promoting coronavirus entry. Priming involves S cleavage by host proteases at the boundary between the S1 and S2 subunits (S1/S2), in a subset of coronaviruses, and at a conserved site upstream of the fusion peptide (S2’) in all known coronaviruses (Belouzard et al., 2009, Burkard et al., 2014, Millet and Whittaker, 2014, Park et al., 2016). The latter site is believed to be the most important for membrane fusion activation. The SARS-CoV and MERS-CoV S receptor-binding domain, designated domain B, exhibits multiple conformational states that modulate the accessibility of the receptor-binding motifs (RBMs) and in turn the ability to interact with host cells. Based on these findings, it was hypothesized that receptor binding may initiate membrane fusion (Gui et al., 2017, Pallesen et al., 2017, Yuan et al., 2017). However, the S glycoprotein of other coronaviruses adopt a closed domain B conformation, incompatible with receptor engagement, indicating that structural rearrangements prior to receptor binding are required for entry (Kirchdoerfer et al., 2016, Shang et al., 2017, Shang et al., 2018, Walls et al., 2016a, Walls et al., 2016b, Xiong et al., 2017). Due to this unusual mechanism of proteolytic activation and RBM conformational masking, our understanding of coronavirus membrane fusion activation remains limited.

Since the S glycoprotein densely decorates the viral surface and is a key player in pathogenesis, it is the main target of neutralizing antibodies and the focus of intense interest for vaccine design. We previously showed that coronavirus S glycoproteins are decorated with an extensive glycan shield comprising up to 100 N-linked oligosaccharides (Walls et al., 2016b, Xiong et al., 2017). Molecular-level information of the carbohydrates attached to the surface of highly pathogenic coronaviruses, however, is lacking. These glycans contribute to S stability during biogenesis, since inhibition of glycosylation by tunicamycin was reported to yield virions lacking S glycoproteins (Rossen et al., 1998) and likely participate in immune evasion via epitope masking (Du et al., 2016, Walls et al., 2016b, Xiong et al., 2017). Studies of the S glycoproteins of MERS-CoV and the bat-specific HKU4 coronavirus suggested that glycans also impact zoonosis by modulating cleavage-site accessibility to proteases for membrane-fusion activation (Yang et al., 2015). The outcome of the arms race between viral evolution mechanisms and the immune system of infected individuals can also lead to the elicitation of antibodies binding glycan-containing epitopes, such as in the case of HIV-1 (Scharf et al., 2015, Stewart-Jones et al., 2016) or Epstein-Barr virus (Snijder et al., 2018). These findings emphasize the necessity to obtain a detailed understanding of the carbohydrates covering coronavirus S glycoproteins to accelerate the development of subunit vaccines and therapeutics.

We previously reported the isolation of highly potent monoclonal neutralizing antibodies from rare memory B cells obtained from SARS-CoV and MERS-CoV survivors (Corti et al., 2015, Traggiai et al., 2004). To understand neutralization, we report here an analysis of the fine molecular structure of the SARS-CoV and MERS-CoV S glycan shields and the cryoelectron microscopy (cryo-EM) study of these glycoproteins in complex with two potent human neutralizing antibodies. Although both antibodies block receptor interaction, the anti-SARS-CoV antibody acts by functionally mimicking receptor attachment and promoting S fusogenic conformational rearrangements through a ratcheting mechanism. We found that the dynamics of the receptor-binding domain alter the apparent binding affinity of coronavirus S trimers for their cognate receptors, a phenomenon that cannot be detected using isolated B domains. The findings presented here elucidate the unique nature of the coronavirus membrane-fusion activation pathway.

Results

The MERS-CoV and SARS-CoV S Glycan Shields

We set out to obtain a blueprint of individual N-linked carbohydrates attached to the surface of the MERS-CoV and SARS-CoV S glycoproteins produced in HEK293F cells. We used the stabilized MERS-CoV S 2P and SARS-CoV S 2P ectodomains, which harbor a double proline substitution between the central helix and the heptad-repeat 1 motif to enhance the stability of the prefusion conformation (Pallesen et al., 2017). We determined that oligosaccharides account for a molecular weight of 121 kDa and 98 kDa for MERS-CoV and SARS-CoV S, respectively ( Figures S1 A and S1B), using multi-angle light scattering, refractometry, and UV spectrophotometry (Veesler et al., 2009). These results suggest that ∼25% of the molecular weight of a S ectodomain corresponds to oligosaccharides, whereas 50% of the HIV-1 mosaic M Env molecular weight is accounted for by glycans (Nkolola et al., 2014). We detected N-linked glycosylations at 22 and 16 unique sites for the MERS-CoV and SARS-CoV S protomers, respectively, using liquid chromatography coupled with electron transfer/high-energy collision dissociation tandem mass spectrometry (LC-MS/MS) (Frese et al., 2013). The data revealed an extraordinary heterogeneity of carbohydrates decorating the two S trimers (Figures 1A and 1B and Tables S1 and S2). Individual sequons were linked to 21 unique glycans on average and up to 64 distinct oligosaccharides for the most heterogeneous sites. The intact glycopeptides were a variety of oligomannose, hybrid, and complex glycans, with or without sialylation and (core) fucosylation. Most of the observed diversity corresponded to hybrid/complex carbohydrates (Figures 1A, 1B, ​1B,S1C,S1C, and S1D and Tables S1 and S2). The detection of glycans with different extent of processing on coronavirus S glycoproteins is reminiscent of the composite nature of the HIV Env (Struwe et al., 2018) or Lassa virus GP (Watanabe et al., 2018) glycan shields. The large number and combinatorial diversity of N-linked glycans covering the surface of MERS-CoV and SARS-CoV S could represent a challenge to overcome for antigen recognition.

Characterization of the Fine Molecular Structure of the MERS-CoV and SARS-CoV S Glycan Shields, Related to Figure 1

(A-B) Quantification of the molecular weight fraction contributed by the N-linked carbohydrates decorating the MERS-CoV (A) and SARS-CoV (B) S glycoproteins expressed using HEK293F cells. Molecular weight estimates were determined using size-exclusion chromatography coupled with multi-angle light scattering, refractometry and UV spectrophotometry(Veesler et al., 2009). (C-D) LC-MS/MS analysis of the fucosylation (C) and sialylation (D) content of the MERS-CoV S 2P and SARS-CoV S 2P ectodomain glycans (in-solution digests). Each N-linked glycosylation site is represented by a pie chart colored according to the number of fucose or sialic acid moieties detected and for which the diameter is scaled based on the number of unique glycopeptides identified. NeuAc: N-acetyl-neuraminic acid.

Characterization of the S Glycan Shield of MERS-CoV and SARS-CoV S Glycoproteins

(A and B) Analysis of the glycans N-linked to MERS-CoV S 2P (A) and SARS-CoV S 2P (B) ectodomain trimers expressed using HEK293F cells. Each site is represented by a pie chart colored according to the processing state detected by LC-MS/MS and for which the diameter is scaled based on the number of unique glycopeptides identified. Glycan assignment was performed as follows: high-mannose, 2 HexNAc; hybrid, 3 HexNAc; complex, ≥4 HexNAc; GlcNAc, N-acetyl glucosamine (detected for endo-H-treated samples).

(C and D) Surface representation of the fully glycosylated MERS-CoV S 2P (C) and SARS-CoV S 2P (D) ectodomain trimers (gray) with N-linked glycans rendered as spheres colored according to the processing state (i.e., corresponding to the largest number of unique N-linked glycans identified by LC-MS/MS, as in A and B).

Domains A–D are labeled in (A) and (B). (C) and (D) were generated using the MERS-CoV S2P/LCA60 and SARS-CoV S2P/S230 structures for which the Fabs were removed for clarity. See also Figures S1 and ​andS2S2 and Tables S1, S2, and S3.

Previous observations of SARS-CoV budding directly from the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and/or from swollen Golgi sacs led to the hypothesis that coronaviruses might only be exposed to a subset of the enzymes of the glycosylation machinery (Ng et al., 2003, Stertz et al., 2007). To address this question, we used LC-MS/MS to characterize in parallel S oligosaccharides on the MERS-CoV England1 and Erasmus Medical Center (EMC)/2012 isolates produced using African green monkey VeroE6 cells, as well as on the purified MERS-CoV S 2P ectodomain trimer recombinantly produced using HEK293F cells. We observed extensive overlap of the types of glycans detected across virion-derived and ectodomain-derived MERS-CoV samples, including the presence of hybrid and complex glycans (Figures S2 A and S2B and Tables S1, S2, and S3). Our data agree with previous work detecting hybrid/complex glycans N-linked to S present in the membrane of authentic SARS-CoV virions (Krokhin et al., 2003, Ritchie et al., 2010), which is consistent with our analysis of the SARS-CoV S 2P ectodomain trimer. Our data indicate that at least a fraction of the MERS-CoV and SARS-CoV virions produced in a cell are exposed to the glycan-processing enzymes residing in the Golgi apparatus during assembly and budding.

Comparison of Glycans N-Linked to Full-Length MERS-CoV S Incorporated in Authentic Virions and to a Purified Ectodomain. Related to Figure 1.

(A-B) LC-MS/MS analysis of S oligosaccharides from MERS-CoV England1 and EMC/2012 virions as well as MERS-CoV S 2P ectodomain trimer (in-gel digests). Colored dots represent individual technical replicate values and histograms represent the experimental mean signal of the relative integrated MS1 peak areas for each glycopeptide upon trypsin (A) or chymotrypsin digestion (B). NeuAc: N-acetyl-neuraminic acid, NeuGc: N-glycolyl-neuraminic acid.

The asymmetric cryoEM reconstructions of MERS-CoV S and SARS-CoV S in complex with human antibodies presented in the following sections respectively resolve glycan densities at 17 and 19 sites, virtually all of them overlapping with the MS/MS data (Figures 1C and 1D). At least the two core N-acetyl glucosamine moieties are resolved for the majority of glycosylation sites, which extend from the surface of both the S1 and S2 subunits. Although both glycoproteins are densely decorated with N-linked glycans, by comparison, the surface of the HIV Env trimer is obstructed by twice as many glycans per accessible surface area. MERS-CoV S and SARS-CoV S trimers share that the regions surrounding the S1/S2 cleavage site and the fusion peptide (near the S2 cleavage site) are more sparsely glycosylated than the rest of each trimer (Figures 1C and 1D). These glycan holes could be important for providing access to activating host proteases and for allowing membrane fusion to take place unimpeded at the onset of infection (Walls et al., 2017, Yang et al., 2015). We suggest that the identified glycan holes could be exploited for epitope-focused immunogen design or therapeutic intervention against coronaviruses. This is supported by the presence of neutralizing antibodies targeting the fusion peptide region in SARS-CoV survivor sera (Zhang et al., 2004), the high sequence conservation of this region among coronavirus S glycoproteins (Walls et al., 2016a), and the identification of a neutralization epitope within a comparable breach of the HIV-1 Env glycan shield (McCoy et al., 2016).

Structure of the MERS-CoV S Glycoprotein in Complex with the Human LCA60 Antibody

The LCA60 antibody was isolated from memory B cells of a MERS-CoV-infected individual and potently neutralized multiple MERS-CoV isolates (i.e., England1, EMC/2012, and Jordan-N3/2012) (Corti et al., 2015). Cryo-EM analysis of the stabilized MERS-CoV S 2P glycoprotein ectodomain in complex with the LCA60 Fab fragment showed full saturation with one Fab bound to each B domain of the homotrimeric S. 3D classification revealed that the complex adopts two distinct conformational states (Figures 2 A–2D and ​andS3 A–S3ES3 A–S3E and Table S4), corresponding to two B domains closed and one B domain open (state 1, ∼50%), as well as one B domain closed and two B domains open (state 2, ∼50%). We determined asymmetric cryoEM reconstructions at 3.5 Å and 3.6 Å resolution for states 1 and 2, respectively (Figures 2A–2D and ​andS3C–S3ES3C–S3E and Table S4), as well as a crystal structure of the isolated LCA60 Fab at 3.0 Å resolution (Table S5). LCA60 Fabs bound to open B domains are weakly resolved in the maps, suggesting marked conformational heterogeneity, whereas the quality of the density is enhanced for closed LCA60/B domains despite radial disorder (Figures S3D and S3E). Analysis of the S/LCA60 contacts was done using the state 1 structure.

An external file that holds a picture, illustration, etc.
Object name is gr2_lrg.jpg

Figure S4

LCA60 Interactions with MERS-CoV S Involve N-Linked Glycans, Related to Figures 2 and ​and33

(A-B) Ribbon diagrams of LCA60 binding to a closed B domain. The A domain from a neighboring protomer is also shown. LCA60 residues interacting or putatively interacting with the glycans at positions N236 and N166 are shown in ball and stick representation (blue: nitrogen, red: oxygen, gray: carbon). LCA60 atoms are colored identically except for carbon atoms that are pink/purple. The color scheme is identical to Figure 2. Selected glycans are labeled based on the N-linked glycosylation sequon numbering. Only the LCA60 variable domains are shown. The cryoEM density corresponding to glycans at positions N166 and N236 is shown as a transparent blue surface.

Our structure rationalizes the effect of the previously described E536AMERS-CoV escape mutant that would disrupt putative electrostatic interactions with CDRH2 residues R50LCA60 and K52LCA60 and/or CDRH3 residue R103LCA60 (Corti et al., 2015) (Figure 3C). It also suggests that the K493EMERS-CoV substitution could alter the positioning of the β5-β6 loop, which might in turn prevent CDRL1 from approaching the B domain, thereby providing a potential explanation for the observed loss of binding (Corti et al., 2015). The T489AMERS-CoV substitution would remove the glycan that extends toward the Fab CDRH2 bound to the closed B domain of the neighboring protomer (Figure 3D). The observed abrogation of LCA60 binding for the T489AMERS-CoV mutant (Corti et al., 2015) might be explained by a loss of these protein/glycan contacts, although only one out of the three bound Fabs interact with the glycan at position N487MERS-CoV.

Comparison of the MERS-CoV S/LCA60 structure with the crystal structure of the MERS-CoV B domain in complex with DPP4 (Lu et al., 2013) shows that the two proteins would clash upon binding to MERS-CoV S and that the Fab and receptor epitopes partially overlap (Figures 3E and 3F). This observation supports the finding that LCA60 and DPP4 compete for binding to MERS-CoV S (Corti et al., 2015). Whereas LCA60 can bind to all possible conformations of the B domain, DPP4 binding strictly requires opening of the B domain due to burial of its binding site in the closed conformation.

Structure of the SARS-CoV S Glycoprotein in Complex with the Human S230 Antibody

The S230 antibody was isolated from memory B cells of a SARS-CoV-infected individual and potently neutralized a broad spectrum of SARS-CoV isolates of human and animal origin (Rockx et al., 2008, Traggiai et al., 2004). Cryo-EM characterization of the stabilized SARS-CoV S 2P glycoprotein in complex with the S230 Fab revealed that the particle images could be divided into SARS-CoV S/S230 complex with (state 1) or without (state 2) one closed B domain (Figures 4 A–4D and ​andS3F–S3JS3F–S3J and Table S4). 3D classification of the cryo-EM data revealed that the state 1 complex features multiple orientations of each of the two S230 Fabs associated with intermediate and open conformations of the B domains. In the SARS-CoV S/S230 state 2 complex structure, the three B domains are open, albeit with conformations deviating from 3-fold symmetry, with the three bound Fabs protruding away from the S trimer apex (Figures 4C and 4D). We obtained asymmetric reconstructions at 4.2 Å and 4.5 Å resolution of the SARS-CoV S/S230 complex in states 1 and 2, respectively (Figures 4A–4D and ​andS3H–S3JS3H–S3J and Table S4). The large conformational heterogeneity of the SARS-CoV S/S230 complex contrasts with the limited number of structural states detected for the MERS-CoV S/LCA60 complex. The marked mobility of the B domain/S230 regions, which adopt a continuum of conformations in both structures, limited the resolution of this part of the map. We therefore determined a crystal structure of the isolated S230 Fab at 1.5 Å resolution to assist interpretation of the data (Table S5).

An external file that holds a picture, illustration, etc.
Object name is gr5_lrg.jpg

Figure S6

Effect of S230 or ACE2 on Fusogenic Conformational Changes of Pre-cleaved SARS-CoV S, Related to Figure 6

The effect of Fab S230 (A-B) or of the ACE2 ectodomain (C-D) on the conformational state of the wild-type SARS-CoV S ectodomain trimer was analyzed using single-particle electron microscopy of negatively stained samples. (A-D) Estimates of the fraction of particles corresponding to each state are represented as pie charts based on the number of particle images clustered in each group after reference-free 2D classification. Only prefusion and postfusion conformations were included in the calculations and the results are rendered using bins with a minimal width of 5%.

To explore whether these findings could be detected in the context of virions, we analyzed the structural rearrangements of the full-length SARS-CoV S trimer embedded in the membrane of infectious murine leukemia (pseudo)virus (MLV)(Millet and Whittaker, 2016). Refolding of coronavirus S glycoproteins to the postfusion conformation can be detected by the appearance of a proteinase-K-resistant band migrating at approximately 55 kDa when analyzed by SDS-PAGE. This molecular species comprises the postfusion 6-helix bundle, assembled from the heptad repeats 1 and 2, since its formation could be inhibited in the presence of a heptad-repeat-derived peptide that prevents completion of the conformational transition (Matsuyama and Taguchi, 2009). Addition of the S230 Fab (Figure 7 A) or the ACE2 ectodomain (Figure 7B) to SARS-CoV S-pseudotyped MLV in the presence of trypsin led to the formation of a proteinase-K-resistant band migrating at approximately 55 kDa, thereby demonstrating that both the antibody and the natural receptor promoted S fusogenic conformational changes in the context of a membrane-embedded full-length S.

STAR★Methods

Key Resources Table

 

REAGENT or RESOURCE SOURCE IDENTIFIER
Antibodies

SARS-CoV S polyclonal antibody ThermoFisher Cat# PA1-41385; RRID: AB_1087215


Lot# TI2631279
AlexaFluor680-conjugated AffiniPure Goat Anti Rabbit IgG JacksonImmuno (Gift from Michael Ailion lab) Cat# 111-625-144; RRID: AB_2338085

Lot# 114199

Bacterial and Virus Strains

MERS-EMC/2012 Gift from Bart Haagmans and Ron Fouchier GenBank:JX869059.2
MERS-England 1 Corti et al., 2015 GenBank: : KC164505.2

Chemicals, Peptides, and Recombinant Proteins

Trypsin ThermoFisher Ref# 90057 Lot# TG269188
Chymotrypsin Sigma-Aldrich Cat# 9004-07-3
Alphalytic Protease Sigma-Aldrich Cat# A6362
AspN Endoproteinase NEB Cat# P8104S
EndoH NEB Cat# P0702S Lot# 0181603
EndoF3 CalBIOCHEM Cat# 324727 Lot# 2754801
Proteinase K ThermoScientific Cat# EO0491 Lot# 00656887
EDC ForteBio, Pall Cat# 18-1033
Lot # SF252306
Sulfo-NHS ForteBio, Pall Cat# 18-1067
Lot# R124327
Uranyl Formate Electron Microscopy Sciences Cat# 22451
Lot# 150212

Deposited Data

Raw and Analyzed Mass Spectrometry Data This Paper PRIDE: PDX010494
MERS-CoV S2P/LCA60 cryoEM maps This Paper EMDB: 0401, 0402
MERS-CoV S2P/LCA60 atomic models This Paper PDB:6NB3, 6NB4
SARS-CoV S 2P/S230 cryoEM maps This Paper EMDB: 0403, 0404
SARS-CoV S 2P/S230 atomic models This Paper PDB: : 6NB6, 6NB7
LCA60 crystal structure This Paper PDB: 6NB5
S230 crystal structure This Paper PDB: 6NB8

Experimental Models: Cell Lines

Freestyle HEK293 ThermoFisher Cat# R79007
HEK293T/17 adherent Millet and Whittaker, 2016 ATCC CRL-11268
Expi293F ThermoFisher Cat# A14527
Vero(C1008)E6 adherent ECACC General Collection Cat# 85020206

Recombinant DNA

pOPING – MERS-CoV S 2P GeneArt N/A
pOPING – SARS-CoV S 2P GeneArt N/A
pcD5 - ACE2

Raj et al., 2013

N/A
LCA60

Corti et al., 2015

N/A
S230

Rockx et al., 2008

N/A
pcDNA3.1(-) –Full-length wild-type SARS-CoV S

Millet and Whittaker, 2016

N/A
pCMV-murine leukemia virus gag-pol

Millet and Whittaker, 2016

N/A
pTG-Luciferase

Millet and Whittaker, 2016

N/A
pCAGGS-SARS-CoV-S1-Fc

Raj et al., 2013

N/A
pCAGGS-MERS-CoV-S1-Fc

Raj et al., 2013

N/A

Software and Algorithms

UCSF Chimera https://www.rbvi.ucsf.edu/chimera/
UCSF ChimeraX https://www.rbvi.ucsf.edu/chimerax/
GCTF https://www.mrc-lmb.cam.ac.uk/kzhang/Gctf/
COOT https://www2.mrc-lmb.cam.ac.uk/personal/pemsley/coot/
Relion https://www2.mrc-lmb.cam.ac.uk/relion/index.php?title=Main_Page
Protein Metrics Byonic software https://www.proteinmetrics.com/products/byonic/
PHENIX http://www.phenix-online.org/
PISA http://www.ebi.ac.uk/msd-srv/prot_int/pistart.html
Rosetta https://www.rosettacommons.org/software
Leginon http://emg.nysbc.org/redmine/projects/leginon/wiki/Leginon_Homepage
DoG Picker http://emg.nysbc.org/redmine/projects/software/wiki/DoGpicker
Privateer http://www.ccp4.ac.uk/html/privateer.html
Buster https://www.globalphasing.com/buster/
CryoSPARC https://cryosparc.com
REFMAC5 http://www.ccp4.ac.uk/html/refmac5

Other

Octet Red ForteBio, Pall https://www.fortebio.com/octet-RED96.html
Amine Reactive 2nd Generation (AR2G) Biosensors ForteBio, Pall Part# 18-5092
Lot# 1805262
HisTALON Superflow cartridge Takara Cat# 635683
Lot# 1509573A
Superose 6 Increase 10/300 GE Life Sciences Cat# 29-0915-96
Lot# 10226998
Lacey Formvar/Carbon 400 mesh, Cu Grids Ted Pella Prod# 01885-F
Lot# 020218

 

Contact for Reagent and Resource Sharing

Further information and requests for resources and reagents should be directed to and will be fulfilled by the Lead Contact, David Veesler (dveesler@uw.edu).

Experimental Model and Subject Details

 

Cell lines

HEK293F is a female human embryonic kidney cell line transformed and adapted to grow in suspension (Life Technologies). HEK293F cells were grown in 293FreeStyle expression medium (Life Technologies), cultured at 37°C with 5% CO2 and 150 rpm. HEK293T/17 is a female human embryonic kidney cell line (ATCC). HEK293T/17 cells were cultured at 37°C with 5% CO2 in flasks with DMEM + 10% FBS + penicillin-streptomycin + 10mM HEPES. Expi293F is a female human embryonic kidney cell line transformed and adapted to grow in suspension (Life Technologies). Expi293F cells were grown in Expi293F expression medium, cultured at 37°C, 5% CO2 and 150 rpm. VeroE6 is a female kidney epithelial cell from African green monkey. VeroE6 cells were grown in serum-free medium (VP-SFM; ThermoFisher) at 37°C and 5% CO2. Cells lines were not tested for mycoplasma contamination nor authenticated except for the VeroE6 cells.

Method Details

 

Construct design

Genes encoding for the ectodomains of both MERS-CoV and SARS-CoV S were synthesized by GeneArt (ThermoFisher Scientific) and placed into a modified pOPING vector with its original N-terminal mu-phosphatase signal peptide, and an engineered C-terminal extension: SG-RENLYFQG (TEV protease site), GGGSG-YIPEAPRDGQAYVRKDGEWVLLSTFL (foldon trimerization motif), G-HHHHHH (hexa-histidine tag), just upstream of the predicted transmembrane region (YNK for MERS-CoV S and YIK for SARS-CoV S). The MERS-CoV S1/S2 furin cleavage site was mutated and both SARS-CoV and MERS-CoV S were stabilized with the 2P mutations (). The SARS-CoV S1 and ACE2 ectodomain constructs were fused to a sequence encoding a thrombin cleavage site and a human Fc fragment at the C-terminal end (kind gifts from Berend-Jan Bosch), as previously described ().

 

Protein expression and purification

The SARS-CoV S 2P and MERS-CoV S 2P ectodomains were produced in 500mL HEK293F cells grown in suspension using FreeStyle 293 expression medium (Life technologies) at 37°C in a humidified 8% CO2 incubator rotating at 130 rpm The cultures were transfected using 293fectin (ThermoFisher Scientific) with cells grown to a density of 1 million cells per mL and cultivated for three days. The supernatants were harvested and cells resuspended for another three days, yielding two harvests. Clarified supernatants were purified using a 5mL Cobalt affinity column (Takara). Purified protein was filtered or concentrated and flash frozen in Tris-saline (50 mM Tris pH 8.0, 150 mM NaCl) prior to negative staining and cryo-EM analysis. Wild-type SARS-CoV S was expressed in 293F cells and purified the same way as the SARS-CoV S 2P. Wild-type SARS-CoV S was filtered through 0.2 μm filter and the quality of the protein was assessed by negative stain electron microscopy and SDS-PAGE. Wild-type SARS-CoV S was not frozen and was stored at 4°C and used within 7 days of purification.

Expression and purification of human angiotensin-converting enzyme ectodomain (ACE2, residues 1–614) fused to the Fc region of human IgG (hFc) was performed following the protocol previously described for CEACAM1a() and cleavage of the Fc fragment was achieved using trypsin or thrombin. SARS-CoV S1-Fc was produced in 250mL HEK293F cells grown in suspension using FreeStyle 293 expression medium (Life technologies) at 37°C in a humidified 8% CO2 incubator rotating at 130 rpm The cultures were transfected using 293fectin (ThermoFisher Scientific) with cells grown to a density of 1 million cells per mL and cultivated for six days. The supernatant was harvested, clarified and incubated with 0.25mL protein A beads (0.5 mL slurry) (GenScript) overnight. Beads were washed thoroughly with phosphate buffered saline prior to elution with 0.1M glycine pH3.0 which was immediately neutralized with 1M Tris pH8.5. LCA60 and S230 Fabs were expressed using transient transfection of Expi293F cells, purified by affinity chromatography using CaptureSelect CH1-XL column (ThermoFisher), buffer exchanged to phosphate buffer saline using a HiTrap fast desalting column (GE Healthcare) and sterilized through a 0.2 μm filter.

 

Pseudovirus production

MLV-based SARS-CoV S-pseudotyped were prepared as previously described (). HEK293T cells were cotransfected with a SARS-CoV S encoding-plasmid, a MLV Gag-Pol packaging construct and the MLV transfer vector encoding a luciferase reporter using the Lipofectamine 2000 transfection reagent (Life Technologies) according to the manufacturer’s instructions. Cells were incubated for 5 hours at 37°C with 5% CO2 with transfection medium. Cells were then washed with DMEM 2X and DMEM containing 10% FBS was added for 12 hours. The cells were washed again 2X with DMEM and were kept in DMEM without FBS for 48 hours (). The supernatants were then harvested and filtered through 0.45-μm membranes.

 

MERS-CoV production

Virions were purified from the supernatant of infected Vero E6 cells. Cells were infected at 90% confluence at multiplicity of infection of 0.01, in Serum Free Medium (VP-SFM; ThermoFisher Scientific). Cultures were maintained at 37°C, 5% (v/v) CO2 until 3 days post infection when the culture supernatant was removed. Approximately 50% of cells were rounding, but most remained attached to the growth surface. For virion purification, culture supernatant was clarified by centrifugation at 1,400 g for 10 min then overlaid on a cushion of 20% (w/w) Sucrose in Hanks Buffered Saline solution (HBSS: ThermoFisher Scientific).Supernatant virions were centrifuged through the cushion at 100,000 g for 90 min at 4°C. Pelleted virions were resuspended in HBSS and disrupted by heating for 10 min at 95°C in 1% (w/v) sodium dodecyl sulfate. All live virus work was undertaken under UK ACDP Containment level 3 conditions.

 

MERS-CoV S/LCA60 complex formation

Flash frozen MERS-CoV 2P stabilized S at 5mg/mL was incubated in a 1:1.5 molar ratio with LCA60 at 2.3 mg/mL on ice for three hours. Trypsin at 3 μg/mL was added for twenty minutes at 37°C prior to injection over a gel filtration column (Superose 6 10/300 from GE Life Sciences) equilibrated in 20mM Tris pH8.0 and 150mM NaCl. The complex peak fractions were concentrated to 0.5 mg/mL. 3 μL was applied to a glow discharged (20 s at 20 mA) lacey carbon copper grid with a thin layer of evaporated continuous carbon prior to plunge freezing into liquid ethane with a Mark IV vitrobot (ThermoFisher Scientific) using −1 blot force and 2 s blot time at 95% humidity and 25°C.

 

SARS-CoV S/S230 complex formation

Lacey carbon copper grids were coated with a thin-layer of continuous carbon using a carbon evaporator and glow discharged for 20 s at 20 mA. Flash frozen SARS-CoV 2P stabilized S was diluted to 0.05 mg/mL and 2 μl was applied to the grid and incubated for 1 min. Subsequently, the grid was washed three times in Tris-saline buffer before 2 μL of S230 Fab at 0.02 mg/mL was applied to the grid and incubated for five minutes. The grid was washed again three times with Tris-saline after the Fab incubation and manually blotted prior to plunge freezing into liquid ethane at room temperature.

 

Cryo-EM data collection

Data were acquired using the Leginon software () to control an FEI Titan Krios transmission electron microscope operated at 300 kV and equipped with a Gatan K2 Summit direct detector and Gatan Quantum GIF energy filter, operated in zero-loss mode with a slit width of 20 eV. Automated data collection was carried out using Leginon at a nominal magnification of 105,000x with a pixel size of 0.685 Å. The dose rate was adjusted to 8 counts/pixel/s, and each movie was acquired in super-resolution mode fractionated in 50 frames of 200 ms. For MERS-CoV S/LCA60, 2,400 micrographs were collected in a single session with a defocus range comprised between 0.6 and 3.0 μm. For SARS-CoV S/S230, 5,900 images were collected in a single session with a defocus range comprised between 0.8 and 3.0 μm.

 

CryoEM data processing of MERSCoV S/LCA60

Movie frame alignment was carried out with MotionCorr2 () using a dose weighting of 40 e-/Å2. The parameters of the microscope contrast-transfer function were estimated with GCTF (). Particles were automatically picked with DoGPicker () through the Appion interface (). Particle images were extracted and processed with Relion3.0 () with a box size of 768 pixels2 binned to 384 pixels2 yielding a pixel size of 1.37Å. Reference free 2D classification was used to parse 240,000 particles from the original 500,000 particle images using Relion3.0. An initial model was generated from PDBID 5W9J with all MERS-CoV S domain B closed and removing the G4 Fab (). Relion3.0 3D classification with C1 symmetry was utilized to select the ∼126,000 best particles for state 1 and the ∼114,000 best particles for state 2. CTF refinement in Relion3.0 was used to refine per-particle defocus values. Particles images from each state were subjected to the Bayesian polishing procedure implemented in Relion3.0 (, ) and 3D refinement before performing 3D classification, without refining angle and shifts, using soft masks focusing on the B domains and Fabs with a tau factor of 50. 82,000 and 78,000 particles were selected for states 1 and 2, respectively. Particle images from state 1 underwent another round of domain B/LCA60 focused classification to select 54,000 particles used for the final reconstruction. Finally, CryoSPARC non-uniform refinement () was used to obtain the final reconstructions at 3.5 and 3.6 Å resolution, respectively, using soft masks excluding the open B domains and bound Fabs. Reported resolutions are based on the gold-standard FSC = 0.143 criterion (, ) and Fourier shell correlation curves were corrected for the effects of soft masking by high-resolution noise substitution(). Local resolution estimation, filtering and sharpening was carried out using CryoSPARC. Analysis was carried out using the state 1 structure since the reconstruction is best resolved.

 

CryoEM data processing of SARS-CoV S/S230

Movie frame alignment was carried out with MotionCorr2 () using a dose weighting of 40 e-/Å2. The parameters of the microscope contrast-transfer function were estimated with GCTF (). Particles were automatically picked with DoGPicker () through the Appion interface (). Particle images were extracted and processed with Relion3.0 () with a box size of 768 pixels2 binned to 72 pixels2 (for 2D classification), 128 pixels2 (for 3D classification) or 384 pixels2 (for 3D refinement, yielding a pixel size of 1.37Å). Two rounds of Relion reference-free 2D classification were used to select ∼350,000 particles clustering in well-defined class averages. An initial model was generated from a SARS-CoV S structure with all B domains closed (PDB: 5X58) (). Relion 3D classification without applying symmetry was utilized to select ∼162,000 particle images for state 1 (including numerous conformations of the two bound Fabs as well as partial occupancy) and ∼126,000 particle images for state 2 (including numerous conformations of the three bound Fabs as well as partial occupancy). Particle images in each subset were then subsequently subjected to a new round of 3D classification without imposing symmetry and using the same initial model as for the previous round. A subset of ∼65,000 particle images from state 1 and ∼71,000 particle images from state 2 were selected based on reduced conformational heterogeneity of the bound Fabs (which exhibit a continuum of conformational states) and independently used to run 3D auto-refinements using Relion. Particle images from each state were subjected to the Bayesian polishing procedure implemented in Relion3.0 (, ) and 3D refinement before performing 3D classification, without refining angle and shifts, using soft masks focusing on the B domains and Fabs with a tau factor of 30. ∼23,000 and 20,000 particles were selected for states 1 and 2, respectively, based on mobility of the bound Fabs which were less well resolved than SARS-CoV S (especially the S2 subunit) in the maps. Finally, CryoSPARC non-uniform refinement () was used to obtain the final reconstructions at 4.2 Å and 4.5 Å resolution for states 1 and 2, respectively. Reported resolutions are based on the gold-standard FSC = 0.143 criterion (, ) and Fourier shell correlation curves were corrected for the effects of soft masking by high-resolution noise substitution (). Local resolution estimation, filtering and sharpening was carried out using CryoSPARC.

 

CryoEM Model building and analysis

UCSF Chimera () and Coot were used to fit atomic models (PDB: 5W9J for MERS and PDB: 5X58 for SARS) into the cryoEM maps. The crystal structure of LCA60 or S230 were also fit into density using UCSF Chimera. The models were subsequently manually rebuilt using Coot (, ). N-linked glycans were hand-built into the density where visible and the models were refined and relaxed using Rosetta (). Glycan refinement relied on a dedicated Rosetta protocol, which uses physically realistic geometries based on prior knowledge of saccharide chemical properties (), and was aided by using both sharpened and unsharpened maps. Models were analyzed using MolProbity () and privateer (). Figures were generated using UCSF ChimeraX ().

 

Negative stain electron microscopy

Protein was adsorbed to glow-discharged carbon-coated copper grids for 1 min prior to a 3X wash with water and 2% uranyl formate staining. Micrographs were recorded using the Leginon software () on a 100kV FEI Tecnai G2 Spirit with a Gatan Ultrascan 4000 4k x 4k CCD camera at 67,000 nominal magnification. The defocus ranged from 1.0 to 2.0 μm and the pixel size was 1.6 Å. Particles were picked automatically in a reference free manner using DogPicker. Contrast transfer function (CTF) estimation was performed using GCTF (). Class averages were generated using Relion2.1 ().

 

Crystallization, data collection and data processing of LCA60 and S230

Fab LCA60 crystals were grown in hanging drop set up with a mosquito at 20°C using 150 nL protein solution and 150 nL mother liquor solution containing 30% (v/v) Jeffamine ED-2001 pH 7.0 and 0.1 M HEPES pH 7.0. The LCA60 dataset was collected at the ALS beamline 5.0.1 and processed to 3.0 Å resolution in space group P21, with cell dimensions a = 70.72 Å b = 69.57 Å and c = 93.84 Å, using XDS () and Aimless (). Fab S230 crystals were grown in hanging drop set up with a mosquito at 20°C using 150 nL protein solution and 150 nL mother liquor solution containing 3.5 M sodium formate pH 7.0. Crystals were cryo-protected using the mother liquor solution supplemented with 30% glycerol. The S230 dataset was collected at the ALS beamline 5.0.1 and processed to 1.5 Å resolution in space group P212121 using XDS and Aimless. The structures of Fab LCA60 and Fab S230 were solved by molecular replacement using Phaser () and homology models as search models. The coordinates were subsequently improved and completed using Buccaneer () and COOT (, ) and refined with BUSTER-TNT () and REFMAC5 (). Simulated annealing and omit map calculations were performed in Phenix (). The quality of the crystal structures were analyzed using MolProbity (). Crystallographic data collection and refinement statistics are shown in Table S4.

 

Ligand-induced conformational change analysis using negative staining EM

The wild-type SARS-CoV S ectodomain trimer at 1 mg/mL (7.5 μM spike monomer) was incubated with equimolar amount of Fab S230 or 4-fold molar excess of ACE2 for 30 min or overnight (20-30 hours) on ice. Samples were taken at the end of the incubation and imaged by negative staining EM. The incubation mixtures were also subjected to digestion with trypsin at 1.6 μg/mL at room temperature and reactions were analyzed by SDS-PAGE at different time points. The digestion reaction was stopped by addition of 1.5 mM PMSF after 15 min for imaging by negative staining EM. To visualize the effect of ligand binding on pre-digested wild-type SARS-CoV S ectodomain trimer, the protein at 1 mg/mL was digested with 1.6 μg/mL trypsin for 15 min at room temperature before stopping the reaction using 1.5 mM PMSF. The pre-digested wild-type SARS-CoV S ectodomain trimer was incubated with S230 or ACE2 on ice for 30 min or overnight before negative staining EM imaging.

 

Ligand-induced conformational change analysis using Western-blotting

SARS-CoV S pseudovirions were thawed and incubated either with an equal volume of buffer, 10 μM of the ACE2 ectodomain or 500 nM S230 Fab for 30 min or 2 hours on ice. Trypsin (5 μg/mL) was then added to these samples for 30 min at 37°C. Subsequently, the samples were supplemented with 10 μg/mL proteinase K for 30 min at 4°C. 6X SDS-PAGE loading buffer was then added to all samples prior to boiling at 95°C for 5 min. Samples were run on a 4%–15% gradient Tris-Glycine Gel (BioRad) and transferred to PVDF membranes. An anti-S2 SARS-CoV S polyclonal primary antibody (1:1,500 dilution, ThermoFisher) and an Alexa Fluor 680-conjugated goat anti-rabbit secondary antibody (1:20,000 dilution, Jackson Laboratory) were used for Western-blotting. A LI-COR processor was used to develop images.

 

Mass spectrometry

In solution: MERS-CoV S or SARS-CoV S were either unaltered or subjected to Endo-F and Endo-H deglycosylation treatment. Two microliters of the deglycosylases were allowed to incubate with 20 μg of S for 4-14 hr in 50mM sodium acetate pH 4.4 at 37°C in a 20 μL reaction. 6 μg of S were then incubated in 100mM Tris pH 8.5, 2% sodium deoxycholate, 10mM tris(2-carboxyethyl)phosphine, and 40mM iodoacetamide at 95°C for five minutes and 25°C for thirty minutes in the dark. Denaturated, reduced, and alkylated S (1.6 μg) was then diluted into fresh 50mM Ammonium bicarbonate and incubated for 14 hr at 37°C either with 0.032 μg of trypsin (Sigma Aldrich), chymotrypsin (Sigma Aldrich), trypsin then sequentially chymotrypsin, alpha lytic protease (Sigma), or AspN protease (Pierce). Formic acid was then added to a final concentration of 2% and the samples spun at 14,000 rpm for 20 min and then again for 5 min to precipitate the sodium deoxycholate and collect the peptides from the supernatants. The SARS S digests with trypsin, chymotrypsin and alpha lytic protease were processed in parallel after cotton-enrichment of glycopeptides. Approximately 0.5 mg of cotton wool was packed into 100 μL pipette tips. Glycopeptides were diluted in 80% acetonitrile with 0.1% formic acid and bound to the cotton plug, followed by washing of the cotton plug with 80% acetonitrile with 0.1% formic acid. Glycopeptides were eluted in 0.1% formic acid in water.

In gel: 120 μL of MERS-CoV England1 and EMC2012 virions and 40 μg of purified MERS2P were run on a 4%–15% gradient Tris-Glycine Gel (BioRad). One lane of each sample was loaded with 40 μL while a second lane was loaded with 40 μL, allowed to run for 2 min, and loaded with another 40 μL. The bands were excised and washed with milliQ water and acetonitrile. 1 mg/mL DTT in 50mM ammonium bicarbonate was incubated with the gel pieces at 60°C for 1 hour. Following an acetonitrile wash, 10 mg/mL iodoacetamide in 50mM ammonium bicarbonate was incubated for 30 min at room temperature in darkness. Following extensive washes, either 30 μg/mL trypsin or chymotrypsin in ammonium bicarbonate was incubated with the gel pieces for 1.5 hours on ice. The solution was replaced with ammonium bicarbonate and incubated overnight at 37°C. The supernatant was collected and dried down in a speedvac for 1 hr. The peptides were reconstituted in 40 μL 10% formic acid, 5% DMSO.

Peptide supernatant was collected and between 4 and 8 μL were run on a Orbitrap Fusion Tribrid (ThermoFisher Scientific) mass spectrometer. A 35 cm analytical column and a 3cm trap column filled with ReproSil-Pur C18AQ 5 μm (Dr. Maisch GMBH) beads was used. Nanospray LC-MS/MS was used to separate peptides over a 110-min gradient from 5% to 30% acetonitrile. A positive spray voltage of 2100 was used with an ion transfer tube temperature of 350°C. An electron-transfer/higher energy collision dissociation ion fragmentation scheme was used (). The supplemental higher energy collision dissociation energy was 0.15 for the runs. A resolution setting of 120,000 with an AGC target of 2∗105 was used for MS1, and a resolution setting of 30,000 with an AGC target of 1∗105 was used for MS2. The data was then analyzed using Byonic () against a custom database of recombinant coronavirus spike proteins, searching for glycan modifications with 12/24 ppm search windows for MS1/MS2, respectively. The in-solution digestions of the recombinant ectodomain were searched against a custom database of recombinant coronavirus spike proteins, proteases, and common contaminants. The in-gel digestion experiments were first searched against a database comprised of the full MERS-CoV proteome and the full Chlorocebus sabaeus (virus produced in VeroE6 cells) or human proteome (ectodomain produced in HEK293F cells) retrieved from UniProt, with variable N-linked glycosylations omitted from the search to identify background contaminants. The top 16 contaminants were then assembled together with the S sequence into a focused database for the glycopeptide identifications. In all experiments, up to three missed cleavages were permitted using C-terminal cleavage at R/K for trypsin, F/Y/W/M/L for chymotrypsin, R/K/F/Y/W/M/L for trypsin-chymotrypsin, T/A/S/V for alpha lytic protease, and N-terminal cleavage at D for AspN. Carbamidomethylation of cysteine was set as fixed modification, methionine oxidation and carbamidomethylation of lysine as variable common 1, glycan modifications as variable common 2, with a variable common max. parameter of 3. The N-linked glycan databases of Byonic were merged into a single non-redundant set of glycan compositions for the searches. All reported glycopeptides in the Byonic results files were manually inspected for quality of fragment assignments. All glycopeptide identifications were merged into a single non-redundant list per sequon. Glycans were classified based on HexNAc content as high-mannose (2 HexNAc), hybrid (3 HexNAc) or complex (> 3 HexNAc). Byonic search results were exported to mzIdentML format to build a spectral library in Skyline () and extract peak areas for individual glycoforms from MS1 scans. The full database of variable N-linked glycan modifications from Byonic was manually added to the Skyline project file in XML format. Byonic search results from in-gel digestions of both virion samples and ectodomain were merged into a single spectral library and manually inspected for quantitation. Reported peak areas were pooled based on the number of HexNAc, Fuc or NeuAc residues to distinguish high-mannose/hybrid/complex glycosylation, fucosylation and sialylation, respectively.

 

SEC-MALS

30 μl of each sample at 2.5 mg/mL were loaded onto a Vanquish column (ThermoFisher Scientific) with Acquity UPLC protein BEH SEC, 450Å, 2.5 μm, 4.6 mm x 150mm (Waters) and passed through a Wyatt μDAWN coupled to a Wyatt Optilab UT-rEX differential refractive index detector. Data were analyzed using Astra 6 software (Wyatt Technology Corp) to quantify the protein and glycan weight.

 

Biolayer interferometry

Assays were performed on an Octet Red instrument at 30°C with shaking at 1,000 RPM. ARG2 biosensors were hydrated in water then activated for 300 s with an NHS-EDC solution (ForteBio) prior to amine coupling. 30 μg/mL SARS-S1-Fc was amine coupled to ARG2 (ForteBio) sensors in pH5.0 10mM acetate (ForteBio) respectively for 600 s (4nm shift) and then quenched with 1M ethanolamine for 600 s. A baseline in 25mM Phosphate pH8.0, 150mM NaCl, 1% BSA was collected for 120 s prior to immersing the sensors in a serial dilution of either ACE2 or S230 for 600 s prior to dissociation in buffer for 600 s. ACE2 concentrations used were 1,000 nm, 333 nM, 111 nM, 37 nM, 12.3 nM, and 4.12 nM. S230 concentrations used were 100 nM, 33.3 nM, 11.1 nM, 3.7 nM, 1.23 nM, and 0.412 nM. Curve fitting was performed using a 1:1 binding model and the ForteBio data analysis software. Mean k on, k off values were determined with a global fit applied to all data.

Quantification and Statistical Analysis

Digestion followed by Western-blotting experiments as well as biolayer interferometry assays were performed in triplicates.

Data and Software Availability

The cryoEM maps and atomic models have been deposited at the Electron Microscopy Data Bank and the Protein Data Bank with accession codes EMDB: 0401 and PDB: 6NB3 (MERS-CoV S/LCA60 state 1), EMDB: 0402 and PDB: 6NB4 (MERS-CoV S/LCA60 state 2), EMDB: 0403 and PDB: 6NB6 (SARS-CoV S/S230 state 1), EMDB: 0404 and PDB: 6NB7 (SARS-CoV S/S230 state 2). The crystal structures have been deposited in the Protein Data Bank with accession codes PDB: 6NB5 (LCA60) and PDB: 6NB8 (S230). The mass spectrometry data have been deposited in the ProteomeXchange consortium (PRIDE) databank with accession codes PRIDE: PDX010494. A list of software used in this study can be found in the Key Resources Table.

Acknowledgments

We are grateful to Thomas Hinds and Ning Zheng for assistance with the crystallization robot and BLI device; to Jerome Cattin-Ortolà, Irini Topalidou, and Michael Ailion for assistance with western blotting; and to Michelle Chen (Wyatt technology) for her help with the light scattering experiments. This study was supported by the National Institute of General Medical Sciences (R01GM120553, D.V.), the National Institute of Allergy and Infectious Diseases (HHSN272201700059C, D.V.), a Pew Biomedical Scholars Award (D.V.), an Investigators in the Pathogenesis of Infectious Disease Award from the Burroughs Wellcome Fund (D.V.), the Netherlands Organisation for Scientific Research (Rubicon 019.2015.2.310.006, J.S.), the European Molecular Biology Organization (ALTF933-2015, J.S.), the Zoonoses Anticipation and Preparedness Initiative (IMI115760, F.A.R.), the Pasteur Institute (M.A.T. and F.A.R.), the Centre National de la Recherche Scientifique (F.A.R.), the LabEx Integrative Biology of Emerging Infectious Diseases (F.A.R.), the University of Washington Arnold and Mabel Beckman CryoEM Center and Proteomics Resource (UWPR95794), and the beamline 5.0.1 at the Advanced Light Source at Lawrence Berkley National Laboratory.

Author Contributions

A.C.W., X.X., J.S., Y.-J.P., and D.V. designed the experiments. A.C.W., X.X., M.A.T., and E.C. designed, expressed, and purified the proteins. A.C.W., X.X., J.Q., and D.V. performed cryo-EM sample preparation, data collection, processing, and built and refined the atomic models. A.C.W. and Y.-J.P. crystallized the Fabs. Y.-J.P. and D.V. processed the diffraction datasets and built and refined the atomic models. A.C.W., X.X., and J.S. performed the MS experiments. A.C.W. and X.X. performed all binding assays. R.G. produced MERS-CoV isolates. M.D., A.L., M.Z., and D.C. provided key reagents. A.C.W., X.X., Y.-J.P. M.A.T., J.S., F.A.R., D.C., and D.V. analyzed the data. A.C.W., X.X., and D.V. prepared the manuscript with input from all authors.

Declaration of Interests

A.L. is the scientific founder and shareholder of Humabs BioMed. D.C. is currently Chief Scientific Officer of Humabs Biomed. The other authors declare no competing financial interests.

Notes

Published: January 31, 2019

Footnotes

 

Supplemental Information includes seven figures and five tables and can be found with this article online at https://doi.org/10.1016/j.cell.2018.12.028.

 

Supplemental Information

 

Table S1. Site-Specific Glycan Identifications of the MERS-CoV S 2P Ectodomain Trimer (In-Solution Digests), Related to Figure 1:

 

Table S2. Site-Specific Glycan Identifications of the SARS-CoV S 2P Ectodomain Trimer (In-Solution Digests), Related to Figure 1:

 

Table S3. Site-Specific Glycan Identifications of the Full-Length S Trimer from Authentic MERS-CoV England1 and EMC/2012 Virions, as well as the MERS-CoV S 2P Ectodomain Trimer (In-Gel Digests), Related to Figure 1:

 

Document S1. Tables S4 and S5:

 

References

  • Adams P.D., Afonine P.V., Bunkóczi G., Chen V.B., Davis I.W., Echols N., Headd J.J., Hung L.-W., Kapral G.J., Gross-Kunstleve R.W. PHENIX: a comprehensive Python-based system for macromolecular structure solution. Acta Crystallogr. D Biol. Crystallogr. 2010;66:213–221. [PMC free article] [PubMed] []
  • Agirre J., Iglesias-Fernández J., Rovira C., Davies C.J., Wilson K.S., Cowtan K.D. Privateer: software for the conformational validation of carbohydrate structures. Nat. Struct. Mol. Biol. 2015;22:833–834. [PubMed] []
  • Belouzard S., Chu V.C., Whittaker G.R. Activation of the SARS coronavirus spike protein via sequential proteolytic cleavage at two distinct sites. Proc. Natl. Acad. Sci. USA. 2009;106:5871–5876. [PMC free article] [PubMed] []
  • Bern M., Kil Y.J., Becker C. Byonic: advanced peptide and protein identification software. Curr. Protoc. Bioinformatics. 2012;Chapter 13 Unit 13.20. [PMC free article] [PubMed] []
  • Blanc E., Roversi P., Vonrhein C., Flensburg C., Lea S.M., Bricogne G. Refinement of severely incomplete structures with maximum likelihood in BUSTER-TNT. Acta Crystallogr. D Biol. Crystallogr. 2004;60:2210–2221. [PubMed] []
  • Brown A., Long F., Nicholls R.A., Toots J., Emsley P., Murshudov G. Tools for macromolecular model building and refinement into electron cryo-microscopy reconstructions. Acta Crystallogr. D Biol. Crystallogr. 2015;71:136–153. [PMC free article] [PubMed] []
  • Burkard C., Verheije M.H., Wicht O., van Kasteren S.I., van Kuppeveld F.J., Haagmans B.L., Pelkmans L., Rottier P.J., Bosch B.J., de Haan C.A. Coronavirus cell entry occurs through the endo-/lysosomal pathway in a proteolysis-dependent manner. PLoS Pathog. 2014;10:e1004502. [PMC free article] [PubMed] []
  • Chen V.B., Arendall W.B., 3rd, Headd J.J., Keedy D.A., Immormino R.M., Kapral G.J., Murray L.W., Richardson J.S., Richardson D.C. MolProbity: all-atom structure validation for macromolecular crystallography. Acta Crystallogr. D Biol. Crystallogr. 2010;66:12–21. [PMC free article] [PubMed] []
  • Chen S., McMullan G., Faruqi A.R., Murshudov G.N., Short J.M., Scheres S.H., Henderson R. High-resolution noise substitution to measure overfitting and validate resolution in 3D structure determination by single particle electron cryomicroscopy. Ultramicroscopy. 2013;135:24–35. [PMC free article] [PubMed] []
  • Corti D., Zhao J., Pedotti M., Simonelli L., Agnihothram S., Fett C., Fernandez-Rodriguez B., Foglierini M., Agatic G., Vanzetta F. Prophylactic and postexposure efficacy of a potent human monoclonal antibody against MERS coronavirus. Proc. Natl. Acad. Sci. USA. 2015;112:10473–10478. [PMC free article] [PubMed] []
  • Cowtan K. The Buccaneer software for automated model building. 1. Tracing protein chains. Acta Crytallogr. D Biol. Crystallogr. 2006;62:1002–1011. [PubMed] []
  • Du L., Tai W., Yang Y., Zhao G., Zhu Q., Sun S., Liu C., Tao X., Tseng C.K., Perlman S. Introduction of neutralizing immunogenicity index to the rational design of MERS coronavirus subunit vaccines. Nat. Commun. 2016;7:13473. [PMC free article] [PubMed] []
  • Emsley P., Lohkamp B., Scott W.G., Cowtan K. Features and development of Coot. Acta Crystallogr. D Biol. Crystallogr. 2010;66:486–501. [PMC free article] [PubMed] []
  • Evans P.R., Murshudov G.N. How good are my data and what is the resolution? Acta Crystallogr. D Biol. Crystallogr. 2013;69:1204–1214. [PMC free article] [PubMed] []
  • Frenz B., Rämisch S., Borst A.J., Walls A.C., Adolf-Bryfogle J., Schief W.R., Veesler D., DiMaio F. Automatically fixing errors in glycoprotein structures with Rosetta. Structure. 2019;27:134–139.e3. [PMC free article] [PubMed] []
  • Frese C.K., Zhou H., Taus T., Altelaar A.F., Mechtler K., Heck A.J., Mohammed S. Unambiguous phosphosite localization using electron-transfer/higher-energy collision dissociation (EThcD) J. Proteome Res. 2013;12:1520–1525. [PMC free article] [PubMed] []
  • Ge X.Y., Li J.L., Yang X.L., Chmura A.A., Zhu G., Epstein J.H., Mazet J.K., Hu B., Zhang W., Peng C. Isolation and characterization of a bat SARS-like coronavirus that uses the ACE2 receptor. Nature. 2013;503:535–538. [PMC free article] [PubMed] []
  • Goddard T.D., Huang C.C., Ferrin T.E. Visualizing density maps with UCSF Chimera. J. Struct. Biol. 2007;157:281–287. [PubMed] []
  • Goddard T.D., Huang C.C., Meng E.C., Pettersen E.F., Couch G.S., Morris J.H., Ferrin T.E. UCSF ChimeraX: Meeting modern challenges in visualization and analysis. Protein Sci. 2018;27:14–25. [PMC free article] [PubMed] []
  • Gui M., Song W., Zhou H., Xu J., Chen S., Xiang Y., Wang X. Cryo-electron microscopy structures of the SARS-CoV spike glycoprotein reveal a prerequisite conformational state for receptor binding. Cell Res. 2017;27:119–129. [PMC free article] [PubMed] []
  • Haagmans B.L., Al Dhahiry S.H., Reusken C.B., Raj V.S., Galiano M., Myers R., Godeke G.J., Jonges M., Farag E., Diab A. Middle East respiratory syndrome coronavirus in dromedary camels: an outbreak investigation. Lancet Infect. Dis. 2014;14:140–145. [PMC free article] [PubMed] []
  • Hu B., Zeng L.P., Yang X.L., Ge X.Y., Zhang W., Li B., Xie J.Z., Shen X.R., Zhang Y.Z., Wang N. Discovery of a rich gene pool of bat SARS-related coronaviruses provides new insights into the origin of SARS coronavirus. PLoS Pathog. 2017;13:e1006698. [PMC free article] [PubMed] []
  • Kabsch W. Xds. Acta Crystallogr. D Biol. Crystallogr. 2010;66:125–132. [PMC free article] [PubMed] []
  • Kimanius D., Forsberg B.O., Scheres S.H., Lindahl E. Accelerated cryo-EM structure determination with parallelisation using GPUs in RELION-2. eLife. 2016;5 [PMC free article] [PubMed] []
  • Kirchdoerfer R.N., Cottrell C.A., Wang N., Pallesen J., Yassine H.M., Turner H.L., Corbett K.S., Graham B.S., McLellan J.S., Ward A.B. Pre-fusion structure of a human coronavirus spike protein. Nature. 2016;531:118–121. [PMC free article] [PubMed] []
  • Kirchdoerfer R.N., Wang N., Pallesen J., Wrapp D., Turner H.L., Cottrell C.A., Corbett K.S., Graham B.S., McLellan J.S., Ward A.B. Stabilized coronavirus spikes are resistant to conformational changes induced by receptor recognition or proteolysis. Sci. Rep. 2018;8:15701. [PMC free article] [PubMed] []
  • Krissinel E., Henrick K. Inference of macromolecular assemblies from crystalline state. J. Mol. Biol. 2007;372:774–797. [PubMed] []
  • Krokhin O., Li Y., Andonov A., Feldmann H., Flick R., Jones S., Stroeher U., Bastien N., Dasuri K.V., Cheng K. Mass spectrometric characterization of proteins from the SARS virus: a preliminary report. Mol. Cell. Proteomics. 2003;2:346–356. [PubMed] []
  • Lander G.C., Stagg S.M., Voss N.R., Cheng A., Fellmann D., Pulokas J., Yoshioka C., Irving C., Mulder A., Lau P.W. Appion: an integrated, database-driven pipeline to facilitate EM image processing. J. Struct. Biol. 2009;166:95–102. [PMC free article] [PubMed] []
  • Li W., Moore M.J., Vasilieva N., Sui J., Wong S.K., Berne M.A., Somasundaran M., Sullivan J.L., Luzuriaga K., Greenough T.C. Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus. Nature. 2003;426:450–454. [PMC free article] [PubMed] []
  • Li F., Li W., Farzan M., Harrison S.C. Structure of SARS coronavirus spike receptor-binding domain complexed with receptor. Science. 2005;309:1864–1868. [PubMed] []
  • Li W., Shi Z., Yu M., Ren W., Smith C., Epstein J.H., Wang H., Crameri G., Hu Z., Zhang H. Bats are natural reservoirs of SARS-like coronaviruses. Science. 2005;310:676–679. [PubMed] []
  • Li W., Zhang C., Sui J., Kuhn J.H., Moore M.J., Luo S., Wong S.K., Huang I.C., Xu K., Vasilieva N. Receptor and viral determinants of SARS-coronavirus adaptation to human ACE2. EMBO J. 2005;24:1634–1643. [PMC free article] [PubMed] []
  • Lu G., Hu Y., Wang Q., Qi J., Gao F., Li Y., Zhang Y., Zhang W., Yuan Y., Bao J. Molecular basis of binding between novel human coronavirus MERS-CoV and its receptor CD26. Nature. 2013;500:227–231. [PMC free article] [PubMed] []
  • MacLean B., Tomazela D.M., Shulman N., Chambers M., Finney G.L., Frewen B., Kern R., Tabb D.L., Liebler D.C., MacCoss M.J. Skyline: an open source document editor for creating and analyzing targeted proteomics experiments. Bioinformatics. 2010;26:966–968. [PMC free article] [PubMed] []
  • Matsuyama S., Taguchi F. Two-step conformational changes in a coronavirus envelope glycoprotein mediated by receptor binding and proteolysis. J. Virol. 2009;83:11133–11141. [PMC free article] [PubMed] []
  • McCoy A.J., Oeffner R.D., Millan C., Sammito M., Uson I., Read R.J. Gyre and gimble: a maximum-likelihood replacement for Patterson correlation refinement. Acta. Crystallogr. D Struct. Biol. 2018;74:279–289. [PMC free article] [PubMed] []
  • McCoy L.E., van Gils M.J., Ozorowski G., Messmer T., Briney B., Voss J.E., Kulp D.W., Macauley M.S., Sok D., Pauthner M. Holes in the Glycan Shield of the Native HIV Envelope Are a Target of Trimer-Elicited Neutralizing Antibodies. Cell Rep. 2016;16:2327–2338. [PMC free article] [PubMed] []
  • Memish Z.A., Mishra N., Olival K.J., Fagbo S.F., Kapoor V., Epstein J.H., Alhakeem R., Durosinloun A., Al Asmari M., Islam A. Middle East respiratory syndrome coronavirus in bats, Saudi Arabia. Emerg. Infect. Dis. 2013;19:1819–1823. [PMC free article] [PubMed] []
  • Menachery V.D., Yount B.L., Jr., Debbink K., Agnihothram S., Gralinski L.E., Plante J.A., Graham R.L., Scobey T., Ge X.Y., Donaldson E.F. A SARS-like cluster of circulating bat coronaviruses shows potential for human emergence. Nat. Med. 2015;21:1508–1513. [PMC free article] [PubMed] []
  • Menachery V.D., Yount B.L., Jr., Sims A.C., Debbink K., Agnihothram S.S., Gralinski L.E., Graham R.L., Scobey T., Plante J.A., Royal S.R. SARS-like WIV1-CoV poised for human emergence. Proc. Natl. Acad. Sci. USA. 2016;113:3048–3053. [PMC free article] [PubMed] []
  • Michielssens S., Peters J.H., Ban D., Pratihar S., Seeliger D., Sharma M., Giller K., Sabo T.M., Becker S., Lee D. A designed conformational shift to control protein binding specificity. Angew. Chem. Int. Ed. Engl. 2014;53:10367–10371. [PMC free article] [PubMed] []
  • Millet J.K., Whittaker G.R. Host cell entry of Middle East respiratory syndrome coronavirus after two-step, furin-mediated activation of the spike protein. Proc. Natl. Acad. Sci. USA. 2014;111:15214–15219. [PMC free article] [PubMed] []
  • Millet J.K., Whittaker G.R. Murine Leukemia Virus (MLV)-based Coronavirus Spike-pseudotyped Particle Production and Infection. Biol. Protoc. 6.otherMillet and Whittaker. 2016;2016 [PMC free article] [PubMed] []
  • Ng M.L., Tan S.H., See E.E., Ooi E.E., Ling A.E. Proliferative growth of SARS coronavirus in Vero E6 cells. J. Gen. Virol. 2003;84:3291–3303. [PubMed] []
  • Nkolola J.P., Bricault C.A., Cheung A., Shields J., Perry J., Kovacs J.M., Giorgi E., van Winsen M., Apetri A., Brinkman-van der Linden E.C. Characterization and immunogenicity of a novel mosaic M HIV-1 gp140 trimer. J. Virol. 2014;88:9538–9552. [PMC free article] [PubMed] []
  • Pallesen J., Wang N., Corbett K.S., Wrapp D., Kirchdoerfer R.N., Turner H.L., Cottrell C.A., Becker M.M., Wang L., Shi W. Immunogenicity and structures of a rationally designed prefusion MERS-CoV spike antigen. Proc. Natl. Acad. Sci. USA. 2017;114:E7348–E7357. [PMC free article] [PubMed] []
  • Park J.E., Li K., Barlan A., Fehr A.R., Perlman S., McCray P.B., Jr., Gallagher T. Proteolytic processing of Middle East respiratory syndrome coronavirus spikes expands virus tropism. Proc. Natl. Acad. Sci. USA. 2016;113:12262–12267. [PMC free article] [PubMed] []
  • Pettersen E.F., Goddard T.D., Huang C.C., Couch G.S., Greenblatt D.M., Meng E.C., Ferrin T.E. UCSF Chimera--a visualization system for exploratory research and analysis. J. Comput. Chem. 2004;25:1605–1612. [PubMed] []
  • Punjani A., Rubinstein J.L., Fleet D.J., Brubaker M.A. cryoSPARC: algorithms for rapid unsupervised cryo-EM structure determination. Nat. Methods. 2017;14:290–296. [PubMed] []
  • Raj V.S., Mou H., Smits S.L., Dekkers D.H., Müller M.A., Dijkman R., Muth D., Demmers J.A., Zaki A., Fouchier R.A. Dipeptidyl peptidase 4 is a functional receptor for the emerging human coronavirus-EMC. Nature. 2013;495:251–254. [PMC free article] [PubMed] []
  • Ritchie G., Harvey D.J., Feldmann F., Stroeher U., Feldmann H., Royle L., Dwek R.A., Rudd P.M. Identification of N-linked carbohydrates from severe acute respiratory syndrome (SARS) spike glycoprotein. Virology. 2010;399:257–269. [PMC free article] [PubMed] []
  • Rockx B., Corti D., Donaldson E., Sheahan T., Stadler K., Lanzavecchia A., Baric R. Structural basis for potent cross-neutralizing human monoclonal antibody protection against lethal human and zoonotic severe acute respiratory syndrome coronavirus challenge. J. Virol. 2008;82:3220–3235. [PMC free article] [PubMed] []
  • Rosenthal P.B., Henderson R. Optimal determination of particle orientation, absolute hand, and contrast loss in single-particle electron cryomicroscopy. J. Mol. Biol. 2003;333:721–745. [PubMed] []
  • Rossen J.W., de Beer R., Godeke G.J., Raamsman M.J., Horzinek M.C., Vennema H., Rottier P.J. The viral spike protein is not involved in the polarized sorting of coronaviruses in epithelial cells. J. Virol. 1998;72:497–503. [PMC free article] [PubMed] []
  • Scharf L., Wang H., Gao H., Chen S., McDowall A.W., Bjorkman P.J. Broadly Neutralizing Antibody 8ANC195 Recognizes Closed and Open States of HIV-1 Env. Cell. 2015;162:1379–1390. [PMC free article] [PubMed] []
  • Scheres S.H., Chen S. Prevention of overfitting in cryo-EM structure determination. Nat. Methods. 2012;9:853–854. [PMC free article] [PubMed] []
  • Shang J., Zheng Y., Yang Y., Liu C., Geng Q., Tai W., Du L., Zhou Y., Zhang W., Li F. Cryo-Election Microscopy Structure of Porcine Deltacoronavirus Spike Protein in the Prefusion State. J. Virol. 2017;92 [PMC free article] [PubMed] []
  • Shang J., Zheng Y., Yang Y., Liu C., Geng Q., Luo C., Zhang W., Li F. Cryo-EM structure of infectious bronchitis coronavirus spike protein reveals structural and functional evolution of coronavirus spike proteins. PLoS Pathog. 2018;14:e1007009. [PMC free article] [PubMed] []
  • Snijder J., Ortego M.S., Weidle C., Stuart A.B., Gray M.D., McElrath M.J., Pancera M., Veesler D., McGuire A.T. An Antibody Targeting the Fusion Machinery Neutralizes Dual-Tropic Infection and Defines a Site of Vulnerability on Epstein-Barr Virus. Immunity. 2018;48:799–811. [PMC free article] [PubMed] []
  • Song W., Gui M., Wang X., Xiang Y. Cryo-EM structure of the SARS coronavirus spike glycoprotein in complex with its host cell receptor ACE2. PLoS Pathog. 2018;14:e1007236. [PMC free article] [PubMed] []
  • Stertz S., Reichelt M., Spiegel M., Kuri T., Martínez-Sobrido L., García-Sastre A., Weber F., Kochs G. The intracellular sites of early replication and budding of SARS-coronavirus. Virology. 2007;361:304–315. [PMC free article] [PubMed] []
  • Stewart-Jones G.B., Soto C., Lemmin T., Chuang G.Y., Druz A., Kong R., Thomas P.V., Wagh K., Zhou T., Behrens A.J. Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B, and G. Cell. 2016;165:813–826. [PMC free article] [PubMed] []
  • Struwe W.B., Chertova E., Allen J.D., Seabright G.E., Watanabe Y., Harvey D.J., Medina-Ramirez M., Roser J.D., Smith R., Westcott D. Site-Specific Glycosylation of Virion-Derived HIV-1 Env Is Mimicked by a Soluble Trimeric Immunogen. Cell Rep. 2018;24:1958–1966. [PMC free article] [PubMed] []
  • Suloway C., Pulokas J., Fellmann D., Cheng A., Guerra F., Quispe J., Stagg S., Potter C.S., Carragher B. Automated molecular microscopy: the new Leginon system. J. Struct. Biol. 2005;151:41–60. [PubMed] []
  • Traggiai E., Becker S., Subbarao K., Kolesnikova L., Uematsu Y., Gismondo M.R., Murphy B.R., Rappuoli R., Lanzavecchia A. An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus. Nat. Med. 2004;10:871–875. [PMC free article] [PubMed] []
  • Vagin A.A., Steiner R.A., Lebedev A.A., Potterton L., McNicholas S., Long F., Murshudov G.N. REFMAC5 dictionary: organization of prior chemical knowledge and guidelines for its use. Acta. Crystallogr. D Biol. Crystallogr. 2004;60:2184–2195. [PubMed] []
  • Veesler D., Blangy S., Siponen M., Vincentelli R., Cambillau C., Sciara G. Production and biophysical characterization of the CorA transporter from Methanosarcina mazei. Anal. Biochem. 2009;388:115–121. [PubMed] []
  • Voss N.R., Yoshioka C.K., Radermacher M., Potter C.S., Carragher B. DoG Picker and TiltPicker: software tools to facilitate particle selection in single particle electron microscopy. J. Struct. Biol. 2009;166:205–213. [PMC free article] [PubMed] []
  • Walls A.C., Tortorici M.A., Bosch B.J., Frenz B., Rottier P.J.M., DiMaio F., Rey F.A., Veesler D. Cryo-electron microscopy structure of a coronavirus spike glycoprotein trimer. Nature. 2016;531:114–117. [PMC free article] [PubMed] []
  • Walls A.C., Tortorici M.A., Frenz B., Snijder J., Li W., Rey F.A., DiMaio F., Bosch B.J., Veesler D. Glycan shield and epitope masking of a coronavirus spike protein observed by cryo-electron microscopy. Nat. Struct. Mol. Biol. 2016;23:899–905. [PMC free article] [PubMed] []
  • Walls A.C., Tortorici M.A., Snijder J., Xiong X., Bosch B.-J., Rey F.A., Veesler D. Tectonic conformational changes of a coronavirus spike glycoprotein promote membrane fusion. Proc. Natl. Acad. Sci. USA. 2017;114:11157–11162. [PMC free article] [PubMed] []
  • Wang M., Yan M., Xu H., Liang W., Kan B., Zheng B., Chen H., Zheng H., Xu Y., Zhang E. SARS-CoV infection in a restaurant from palm civet. Emerg. Infect. Dis. 2005;11:1860–1865. [PMC free article] [PubMed] []
  • Wang Q., Qi J., Yuan Y., Xuan Y., Han P., Wan Y., Ji W., Li Y., Wu Y., Wang J. Bat origins of MERS-CoV supported by bat coronavirus HKU4 usage of human receptor CD26. Cell Host Microbe. 2014;16:328–337. [PMC free article] [PubMed] []
  • Wang R.Y., Song Y., Barad B.A., Cheng Y., Fraser J.S., DiMaio F. Automated structure refinement of macromolecular assemblies from cryo-EM maps using Rosetta. eLife. 2016;5 [PMC free article] [PubMed] []
  • Watanabe Y., Raghwani J., Allen J.D., Seabright G.E., Li S., Moser F., Huiskonen J.T., Strecker T., Bowden T.A., Crispin M. Structure of the Lassa virus glycan shield provides a model for immunological resistance. Proc. Natl. Acad. Sci. USA. 2018;115:7320–7325. [PMC free article] [PubMed] []
  • Xiong X., Tortorici M.A., Snijder J., Yoshioka C., Walls A.C., Li W., McGuire A.T., Rey F.A., Bosch B.J., Veesler D. Glycan shield and fusion activation of a deltacoronavirus spike glycoprotein fine-tuned for enteric infections. J. Virol. 2017 [PMC free article] [PubMed] []
  • Yang Y., Liu C., Du L., Jiang S., Shi Z., Baric R.S., Li F. Two Mutations Were Critical for Bat-to-Human Transmission of Middle East Respiratory Syndrome Coronavirus. J. Virol. 2015;89:9119–9123. [PMC free article] [PubMed] []
  • Yuan Y., Cao D., Zhang Y., Ma J., Qi J., Wang Q., Lu G., Wu Y., Yan J., Shi Y. Cryo-EM structures of MERS-CoV and SARS-CoV spike glycoproteins reveal the dynamic receptor binding domains. Nat. Commun. 2017;8:15092. [PMC free article] [PubMed] []
  • Zhang K. Gctf: Real-time CTF determination and correction. J. Struct. Biol. 2016;193:1–12. [PMC free article] [PubMed] []
  • Zhang H., Wang G., Li J., Nie Y., Shi X., Lian G., Wang W., Yin X., Zhao Y., Qu X. Identification of an antigenic determinant on the S2 domain of the severe acute respiratory syndrome coronavirus spike glycoprotein capable of inducing neutralizing antibodies. J. Virol. 2004;78:6938–6945. [PMC free article] [PubMed] []
  • Zheng S.Q., Palovcak E., Armache J.P., Verba K.A., Cheng Y., Agard D.A. MotionCor2: anisotropic correction of beam-induced motion for improved cryo-electron microscopy. Nat. Methods. 2017;14:331–332. [PMC free article] [PubMed] []
  • Zivanov J., Nakane T., Forsberg B.O., Kimanius D., Hagen W.J., Lindahl E., Scheres S.H. New tools for automated high-resolution cryo-EM structure determination in RELION-3. eLife. 2018;7 [PMC free article] [PubMed] []
  • Zivanov J., Nakane T., Scheres S.H.W. A Bayesian approach to beam-induced motion correction in cryo-EM single-particle analysis. IUCrJ. 2019;6:5–17. [PMC free article] [PubMed] []
Sars-cov

Leave a comment

All comments are moderated before being published